SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|153461|estExt_Genewise1.C_5350011 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|153461|estExt_Genewise1.C_5350011
Domain Number 1 Region: 390-490
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 279-381
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 
Domain Number 3 Region: 146-248
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 96-143
Classification Level Classification E-value
Superfamily Trefoil 0.000000000017
Family Trefoil 0.0022
Further Details:      
 
Domain Number 5 Region: 46-92
Classification Level Classification E-value
Superfamily Trefoil 0.000000157
Family Trefoil 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|153461|estExt_Genewise1.C_5350011
Sequence length 510
Sequence
MKFKLCLLFGLISLVICKVAVRSSSDAVINAIMKGQTSGQGRFDVFHNECSFEDEDRLEC
GKRTYDERECRARGCCWQTCEGCASDIPWCFLAHRMVRSECLVEYEEKDDCGYYGITEGE
CYMRGCCWAPSPLVNSPPCFHKGRVQDVRLVNGDESRGTVEVLHDGAWGTVCDDTFGVEE
ATVVCKALGFEYGTYQNEAYFGEGSGEILMDSIDCDGSEESLTECSHNGWGQHDCSHSED
AGVECSNSGHSSENTAESAESAESAESAESAESAESAKIPIRLVGGNSENEGRVEIFHSE
EWGTICDDEFGPEETRVVCRSMGFYGGYHYGNAHFGEGSGNIWLDGVGCDGDEDSISQCD
HPGWGQHDCSHSEDASVECFEEGQGAVEAAIRLVDGNDEHEGRVEIFHNGQWGTICDDSF
GHEAASVVCRSLGYSDGQYYKGYIGSGRGNIWLDDISCSGNEVSIDQCSHGGWGNHDCSH
SEDVGVQCSNDDQGSGSGAGRQNAYYDQEK
Download sequence
Identical sequences R7TQJ2
jgi|Capca1|153461|estExt_Genewise1.C_5350011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]