SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|153473|estExt_Genewise1.C_5350050 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|153473|estExt_Genewise1.C_5350050
Domain Number 1 Region: 211-315
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 3 Region: 107-206
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|153473|estExt_Genewise1.C_5350050
Sequence length 345
Sequence
MRLVNGDRVGEGRVEVMYNGAWGTVCDDTFGEKEALVVCKSLGYESGEIASFNHFGSGSG
LILLDNMQCNGTEESLLECNKGIIGSNDCSHREDVGLSCTGEQAKHIGEMRLVGGDGDHE
GRVEIFYWEWGTVCDDNFDAKAATVVCKYFGYKRGHPVSNKYGPGEGRILLDMFECETGD
KTLADCGDFYWGLNNCNHSEDAGVRCELEGESSLRLVGGRGDWEGRVEILHDGEWGTICD
DEFNLEEAQVVCRSLGFSNGDWRTDAFFGAGEGRIWLDDFNCDGHEEWIEECNSVYWGIN
NCSHNEDAGVSCYNGDDEDSREDEGYSGSGSGSGYGSGTESDSWP
Download sequence
Identical sequences R7TQJ7
jgi|Capca1|153473|estExt_Genewise1.C_5350050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]