SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|168778|estExt_Genewise1Plus.C_1680016 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|168778|estExt_Genewise1Plus.C_1680016
Domain Number 1 Region: 30-131
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|168778|estExt_Genewise1Plus.C_1680016
Sequence length 132
Sequence
MEGRIGQKIASLEERIIQRVADVAVCDASGDTSLRLVGGPTCNKGRLEVLHDDIWGTVCD
DYFSDNDAALFCRAMGKPYGNAEAIATFGGGYGVIHLDDVRCSGQRDWRSCSHNGWGLNN
CGHEEDVGLHCH
Download sequence
Identical sequences R7V198
jgi|Capca1|168778|estExt_Genewise1Plus.C_1680016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]