SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|170020|estExt_Genewise1Plus.C_6190001 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|170020|estExt_Genewise1Plus.C_6190001
Domain Number 1 Region: 135-239
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00047
Further Details:      
 
Domain Number 2 Region: 247-347
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00067
Further Details:      
 
Domain Number 3 Region: 28-128
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 4 Region: 363-397
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000183
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|170020|estExt_Genewise1Plus.C_6190001
Sequence length 398
Sequence
MAQISIPPKDIRLADGWYDDDEQGEIIELAGRVEILMNGEWGTICDHPFNIEEATAVCTT
LGFTHGLYMNNLEFGQGKGRVWVMADELSSGVSVQQCSSDYPSDEYDKFGCYCSHYSDAG
VTCYNYDGSGEFTEGEVRLADGGSESEGRVEVFHDGLWGTVCYGTFNQKAALIVCRALGY
AGGHSVAFGAFPQINHGPIWIGRLGCHGNESSIMECALMNGETAICNHFQDVGVMCHTEA
EMRSFPEGEIRLVGGVLAGDGRVEIFHHGTWGTLCSDVFNDDIASEICRARGWRYGFAKF
DAHYGAGSGPIWYYDEHCLSDEGTILDCTSIKWGNAYQCYHSHDLGVEYGWYDDDEQGEI
IELAGRVEILMNGEWGTICDHPFNIEEATAVCTTLGFT
Download sequence
Identical sequences R7TJE6
jgi|Capca1|170020|estExt_Genewise1Plus.C_6190001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]