SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|171695|estExt_Genewise1Plus.C_4990006 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|171695|estExt_Genewise1Plus.C_4990006
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00038
Further Details:      
 
Domain Number 2 Region: 325-429
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 221-326
Classification Level Classification E-value
Superfamily SRCR-like 8.24e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00089
Further Details:      
 
Domain Number 4 Region: 432-532
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00075
Further Details:      
 
Domain Number 5 Region: 112-214
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|171695|estExt_Genewise1Plus.C_4990006
Sequence length 533
Sequence
MCCRGSSPASEVRLVGGSNRFEGRLEVYYAQQWGTVCDDEFDDIDAGVFCRMLGYGCGVY
LMSPKEGGPIWLDDIGCNGQEDHVSECPKSSWGITNCGHTEDVSIRCDQHGGSYRLVDGP
HSAEGKVEVFHESTWKAACMTHVIIERICQQLGYLSGKILLDPTEKYGQGSRVIWMNGVS
CYGNESTVQDCSYGEIGFSDCDHNENVYLQCSHQVSLIPDDIRLLNGRSPNEGVLQVLHD
GTWGTVCDDGFDSSVASLFCQLFGFSSGEALLEPDERFGSGNDVIWMDDVICSPEARDLN
ECEFNGWGEVDCDHSEDVSVRCLGERVTLRLVDGALRGFGRLEVFYDGQWGTVCDDGFTN
NEAKVFCSALGYRDGSPSRIQYGKSTGPIWMDDVVCKEAGTSLADCEHAPFGTNNCEHIE
DISLQCVGYIGYPVRLLDGVFKNEGRVEIFLNLEWGTMCGEGFTDLEANVVCRMLGYGRG
ISLGNQYGPGWDNIWVDSLRCHGQEETIIACFGLVFGPGTCDHDSDVSVRCLE
Download sequence
Identical sequences R7TZW8
jgi|Capca1|171695|estExt_Genewise1Plus.C_4990006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]