SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|171985|estExt_Genewise1Plus.C_5350035 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|171985|estExt_Genewise1Plus.C_5350035
Domain Number 1 Region: 111-220
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 16-104
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|171985|estExt_Genewise1Plus.C_5350035
Sequence length 237
Sequence
MRITSALWVELTAQLRLEVWHNSEWGTVCDDSFTENSAMVACKQLGYSEGYTIESAEIEE
GSGQIWLDEVQCSGEEESIAMCPHLEWGNTDCVHGEDVEIKCYAEGEIVTPNVTLRLVSS
TSEERPNRGRVEIFHGSEWGTVCDDMAGVEAAMVICRYLGFTTGTPRPGAYFGAGSGKIW
LDNLQCQGDEGSLEECYHHIWGENDCDHSEDFGVECIDAITDATTSTDSTVQPEDGV
Download sequence
Identical sequences R7TXZ4
jgi|Capca1|171985|estExt_Genewise1Plus.C_5350035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]