SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|172188|estExt_Genewise1Plus.C_90003 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|172188|estExt_Genewise1Plus.C_90003
Domain Number 1 Region: 133-232
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00076
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|172188|estExt_Genewise1Plus.C_90003
Sequence length 233
Sequence
MVGNSRLRLTSSTSSNIGRLEVFHEGNWGAVCDDDFTNEAAAVFCKSLGLPYANAAAIPT
YGFDYSLPILLDQVTCQSALDARYCRHDGWEVHNCDRRENSLINAVDSFAISNFPTNAKP
FASRSYPLKIGNSELRLAGGTSRRGRLEVYHAGEWGTVCDDDFTDEYAAVICKSLGLPFG
NAREIHNFGGGTGKPIHLDQVNCAAATHARHCVHAGWGVNNCQHGEDLGIHCQ
Download sequence
Identical sequences X1ZCM9
jgi|Capca1|172188|estExt_Genewise1Plus.C_90003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]