SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|172488|estExt_Genewise1Plus.C_490127 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|172488|estExt_Genewise1Plus.C_490127
Domain Number 1 Region: 225-383
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 7.16e-44
Family Pentapeptide repeats 0.0000992
Further Details:      
 
Domain Number 2 Region: 91-196
Classification Level Classification E-value
Superfamily POZ domain 1.14e-26
Family Tetramerization domain of potassium channels 0.0096
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|172488|estExt_Genewise1Plus.C_490127
Domain Number - Region: 2-76
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00222
Family Doublecortin (DC) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|172488|estExt_Genewise1Plus.C_490127
Sequence length 395
Sequence
MKRAVVFRNGCDTDGKLIAIDQDIGDVVKTAGEKLGLPSASILFTSLGASVDSTALIRDD
EALYVSCGEPFKAPEKGSANGAFMSPNKQTDWLVLNVGGKLFSTTRSTLVGKETDSMLAR
MFSCNREGSDRWNNSMDESGAFLIDRSPRYFEPILNYLRHGELILDPDVNPRGVLEEARF
FGIQPVVDILELRIQKEEPPGDLSPLTRRDLVLRLIATSTEGELRCQGVNFSGADLSKLD
LRNINFKYAVLAGANLKGANLSQCNFERADLSRSQLDGAQLLAVKMLCVNLEMASMQGCN
FEDPAGNRANMEGANMKQVNLEGSHMAGVNLRVATLKNSNLQNCDLRGAVLAGADLENCD
LSGCDLQEANLRGANLKGAAFELMLNPLHMSQTVR
Download sequence
Identical sequences R7TTH4
jgi|Capca1|172488|estExt_Genewise1Plus.C_490127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]