SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|184961|fgenesh1_pg.C_scaffold_294000020 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|184961|fgenesh1_pg.C_scaffold_294000020
Domain Number 1 Region: 346-445
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|184961|fgenesh1_pg.C_scaffold_294000020
Domain Number - Region: 125-267
Classification Level Classification E-value
Superfamily Tropomyosin 0.000915
Family Tropomyosin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|184961|fgenesh1_pg.C_scaffold_294000020
Sequence length 446
Sequence
MKIFVACILALCCSMIRAQCTTEECSVNEAFAPGSNGDLLHQVQSALKRMFVDLRIISQG
TAQRLNSIEKAMGDLTQETAQRLQSIESGMGDLTYGTVQRFGSLETAMSDLAQGTCQRPA
SFETAMDKLTNLTQGTAQRLGSWETAMGDLTQGTAQRLGSLETAMGDLTQGTAQRLASFE
TAVDKLTNLTQGTAQRLGSLETAMGDLTQGTAQRLASFETAVDKLTNLTQGTAQRLGSLK
TAMGDLTQGTSQRLASFEMAIGNLTQGTSQRLGSLESAMNRQTAGAAQILRSLETAVGDL
SQGPTQGLDAAVNTLTTRMRAMEGRIGQTLALTAERIILRIGDAGSLGLRLADGSENRGR
LEVYHNGEWGTVCDDAFLNADAAVFCRSMEKPYENAEAIASFGGGSGPIYLDNVNCDGHA
YASFCTHRGWGVHDCGHQEDVGLNCQ
Download sequence
Identical sequences R7ULZ3
jgi|Capca1|184961|fgenesh1_pg.C_scaffold_294000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]