SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|186518|fgenesh1_pg.C_scaffold_160000025 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|186518|fgenesh1_pg.C_scaffold_160000025
Domain Number 1 Region: 1098-1168
Classification Level Classification E-value
Superfamily RING/U-box 1.24e-16
Family U-box 0.0073
Further Details:      
 
Domain Number 2 Region: 611-718
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000419
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 37-113
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000235
Family Scavenger receptor cysteine-rich (SRCR) domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|186518|fgenesh1_pg.C_scaffold_160000025
Sequence length 1193
Sequence
MSWIDIAALTVIIISLQVLVIGADEFRLAYPSVSSYEVCGYLQVDTGSGWCTVCNYGLSE
EILSVLCRQMGYGSFLQWSTEKRKKTRAEVFIEISAHCSGIEQLITDCRGYDLTRASVNS
LCVARSIRKMICKATDEESQPDDSGYRNFFVAGNHDLLYNLAESFNDETKSETKYDVNVI
NLNENAAEKLRIINKDELNYKQQFISNHDEIKPLQEKQDEVGEIEPPEMDTSATITNRNE
AINVRKTRSMEGWTTNSDMETDVTTLSWNDYDVTTYPDQQSTKLQLINKDKYWSVEDDIE
STTVADMDATHGRNATTTIKSVSEEHNVATDLYDSASAQYIDSSTITRDLSKVRLDLTTE
LTSISDARSTKVSNVVHEGTPVDISAILSTLRPTQSLGTRDSNENTTEDEPVTRDSMHML
TPAHLPPSMAIKNKTASPQTSSIPNMNQTFKTFSSQSPLSLQPKISSKSSSATPSVQKKN
PYFTTKTPSSASAKTSPLQRSTTSKITLDEEILIEVPKWGLGVQRITGVNQAPTAARQVL
RTPTTPTPYPEFKDKPFVLETLAPAKDKIAEQEYELGNQGDLGNDLNGDGQTKEYTWVQS
CSHFWHTVNGTNQRGVISSPRYPQPYPAAESCKWVLISDLSQTVTIEIIDLNLRQGIDML
SLIAKVDGAFSHVYNLTGDLAGVPNATFVLNSTLIYLEFTTSNYVNKHHRGFKVSYTLNS
PEIIITDKGNEAYHRYLSFRVILILAAMCFLLLVAIVAVFIFWKKDLNRRRSLCQTCCSK
IYHSTCGQSIKILSVWVTPFKPVSAPSMVDMKMHNPQAFPENIIEVNNLREKPPLPSSSV
AYDDTTFVFMKRQRVKQPKPVVQPVLSYNSPQIMTPRSARKNHGLLGMLRSGSKIFPNDK
NAEVRKAITHTPIEVLDGQTPFLDRIEDGFGTFLSNETYTVNKKKEIREAPFIKDDTTKS
VTLQEIRQEKNTQLDNVLHRNIKPENISRTLKEKQNSNFKVDELNLESLDLDDESIEEVS
DLRGTYTIKKEEKRVEVKQPPLKKTVSPALPRKGSRIPVVTPRTDRKNQQISTISSGGFR
VNTNVAGKVSITNKRGDWSTPGEFMCQLSGKVMENPVRADDGFTYEKSVIVNWLQAQSVS
PMTNRKITRQGLKLDSILRGRIQRWRLTQRGDIIQRQSQLKKASENILCDIED
Download sequence
Identical sequences R7V2R0
jgi|Capca1|186518|fgenesh1_pg.C_scaffold_160000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]