SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|189737|fgenesh1_pg.C_scaffold_733000015 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|189737|fgenesh1_pg.C_scaffold_733000015
Domain Number 1 Region: 23-171
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000144
Family Pentapeptide repeats 0.0027
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|189737|fgenesh1_pg.C_scaffold_733000015
Domain Number - Region: 256-365
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0373
Family Pentapeptide repeats 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|189737|fgenesh1_pg.C_scaffold_733000015
Sequence length 400
Sequence
MAPITRSQTMPRNPGADLEAGVLGEPRNPGADLEAGVLGEPRNPGANLEAGVLEEAKNPG
ANLEAGVLEEAKNPGADLEAGVLEEARNPGADLEAEVLREPRHPGADLETGVLGEPRNPE
ADLVEAGVLEEARNPGANLEAGVLKEPRNPGADLETGVLEEARNPGADLEAGMLGEPRNP
GADLEAGVLGEPRNQGVGLETGVLGEPRNPGADLVEAGVLEEARNPGADQEAEVLEEARN
PGADQEAGVLGEPRNPGADLEAGVLEEARNPGADQEAGVLGEARNPGADQEAGVLEEARN
PGADLEVEVLEEARNPGADQEAEVLEEARNPGADLEVEVLGEARNPGADLEAGVLGEARN
PGADLGGDPVAGKQEDLPSASLIEASKPNYCVNLWRTLQM
Download sequence
Identical sequences R7TC77
jgi|Capca1|189737|fgenesh1_pg.C_scaffold_733000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]