SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|192037|fgenesh1_pg.C_scaffold_77000052 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|192037|fgenesh1_pg.C_scaffold_77000052
Domain Number 1 Region: 29-129
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000017
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|192037|fgenesh1_pg.C_scaffold_77000052
Sequence length 146
Sequence
MNVLVLVALLLVLPVAYNASYLELSTAWMLLNNASDLEGKISVIWRNATTSTGAICFCDD
GVFDLSAGNVVCRELEYDEAHLQPSVDGSGSWTIHSVHCDGDEGGLEECSWTVGARSQCQ
LNIVLKCYNHKGGWRASGQRVITPVS
Download sequence
Identical sequences R7TGF4
jgi|Capca1|192037|fgenesh1_pg.C_scaffold_77000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]