SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|194322|fgenesh1_pg.C_scaffold_669000004 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|194322|fgenesh1_pg.C_scaffold_669000004
Domain Number - Region: 36-95
Classification Level Classification E-value
Superfamily PhoU-like 0.00488
Family PhoU-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|194322|fgenesh1_pg.C_scaffold_669000004
Sequence length 100
Sequence
MHFLAALIMLTVLLSGTAAQCTSDQCHRNVAFASGSFDDKLHQLKSEFQRMCIDLRVVKE
LSTSGEKRRDIEAVTQRVVTLESEVRVMDELIERLEERPP
Download sequence
Identical sequences R7TM09
jgi|Capca1|194322|fgenesh1_pg.C_scaffold_669000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]