SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|195254|fgenesh1_pg.C_scaffold_535000010 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|195254|fgenesh1_pg.C_scaffold_535000010
Domain Number 1 Region: 168-267
Classification Level Classification E-value
Superfamily SRCR-like 1.26e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 274-380
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00043
Further Details:      
 
Domain Number 3 Region: 24-133
Classification Level Classification E-value
Superfamily SRCR-like 9.29e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|195254|fgenesh1_pg.C_scaffold_535000010
Sequence length 413
Sequence
MEQFSSVLELIPAEWNAEGEIVTPNVTLRLVSSTSEERPNRGRVEVFHGSEWGTVCDDIA
GVEAAMVICRYLGFTTGTPRPGAYFGAGSGKIWLDNLQCQGDEGSLEECYHHIWGENDCD
HSEDFGVECSKVKHYWSSAYCHVLIPVDAITDATTSTDSTVQPEDGVIALVNGTKIGEGR
VEIFHDGEWGTVCDDNFDEHTASVVCRSLGYYDGWARREAYFGSGKGVIWLDGFGCFGTE
ATLTECQGINFGSNDCSHSEDAGVACFMKEGMEFGVRLADGESDDIGRLEVRHNGEWGTV
CNDGFGEQEAEVVCRSLGFSGGSILPFHRIYLEIGLGSGKIWLEWVSCEGDETSLEDCRH
RDWGLHDCEHIEDVAVACNTGSDEESREEEELSEYEYEYEYGYGTGSYYYSSP
Download sequence
Identical sequences R7TQJ5
jgi|Capca1|195254|fgenesh1_pg.C_scaffold_535000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]