SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|198525|fgenesh1_pg.C_scaffold_437000011 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|198525|fgenesh1_pg.C_scaffold_437000011
Domain Number 1 Region: 24-130
Classification Level Classification E-value
Superfamily SRCR-like 9.16e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|198525|fgenesh1_pg.C_scaffold_437000011
Sequence length 147
Sequence
MQFFYLLIVASLQAGVFGQLTYNEGEMRLTNTGMVDSGRLEVFRFGVWGTVCGYLEPTAA
NVACRQFGYSRGEQLPEELYFVTACDDQPIWVKNFICEGYEQRLMDCGFAQDDDIQNCTH
ADDVYVQCYHDDTVDTTSSYPDCKWQL
Download sequence
Identical sequences R7U6Z8
jgi|Capca1|198525|fgenesh1_pg.C_scaffold_437000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]