SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|201717|fgenesh1_pg.C_scaffold_3168000001 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|201717|fgenesh1_pg.C_scaffold_3168000001
Domain Number - Region: 173-208
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0379
Family Pentapeptide repeats 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|201717|fgenesh1_pg.C_scaffold_3168000001
Sequence length 246
Sequence
MILLALTSVSVLVLRDSLAQGSSDECDDQLIFPESSPIQDARIPLNNATGKMSLIFDRCS
PMFISAYSTNGERMFKISFSNDTVRIKSNNFPRDCNTDLEYWITWDATKFKFGSGLTPDD
LILLRINGQLVDYSGRNLWITWNNSSYSLGRGLRPGTSVIVVDSLDGPLTQLNVNLTTSR
LRGALLNDCGIIHHWFINVFGFECNLSYSGRYRSNRLLGHLLPSVADGVSELGKQTYSVL
LVKRTK
Download sequence
Identical sequences R7UKH2
jgi|Capca1|201717|fgenesh1_pg.C_scaffold_3168000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]