SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|203430|fgenesh1_pg.C_scaffold_13000104 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|203430|fgenesh1_pg.C_scaffold_13000104
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000419
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|203430|fgenesh1_pg.C_scaffold_13000104
Sequence length 146
Sequence
MNVLVLVALLLVLPVAYNASYLELSTAWMLLDDASDLEGKISVIWRNATTSTGAICFCDD
GVFDLSAGNVVCRELEYDEADLQPSVAGNGSWTIHSVHCDGDEDGLEDCSWTVGAKSQCQ
LNIVLKCYNHKVPGCQYHHNRFKLTK
Download sequence
Identical sequences R7V9E5
jgi|Capca1|203430|fgenesh1_pg.C_scaffold_13000104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]