SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|204049|fgenesh1_pg.C_scaffold_150000004 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|204049|fgenesh1_pg.C_scaffold_150000004
Domain Number 1 Region: 23-381
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-55
Family L-arabinose binding protein-like 0.0021
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|204049|fgenesh1_pg.C_scaffold_150000004
Domain Number - Region: 416-501
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0981
Family Pentapeptide repeats 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|204049|fgenesh1_pg.C_scaffold_150000004
Sequence length 913
Sequence
MVIRHMRLEPRVGIMIIRSVVLQCDPGVGANAFYDFIYSKPQVIMMVGTRCSEVTKTLAE
IAPYWNLLLVSHAATSPALSAREKYPTFYRLAQADSSHNAARKTFIRHFEWDKVATIQQD
KDTYTLAIDDMNKDLDVNITLTATFRNSRRDLQDKIQQLKDKDARIIIGSFNEQSAREVF
CEAYKAKLYGPRYVWMLLGGYARNWWTLLDEKTNCTQEQMEDAVEGYISVNGFNSIIGQR
KSESGLSTEDFRKELKLMTSDPESPFAPMTYDTIWAVAATLRDALKGKANRRKVLSKFSY
ENGAALKAEFLEIMGKLDFMGVSGPVTFDGSDRSGVSLIEQNQGGKMVHLALYYPDNKTL
DWKCSGCRDIIWREGRVPADEFTREFRRENVSPEVFLVICAISVVGIFISIFFLAFNLYH
RKLKYIKLSSPRLNNAAVVGCMLVYLAVITLGLDDALLSDKYFPVACTVRAFLLAAGFSL
AFGAMFTKTYRVHAIFRGRQAASIAFKDHRLLIVIGSLLGIDCVVIALWVALDPMQRQVE
ELTEQTSEDNIDLLYIPQLSKCQSQHLIKWLGAFYTYKGLLLLFGVYMAWETRHVKIPAL
NDSQYIGMNIYNVVLSSVTVVALSTLLTDKPTLSYTVISALILLSTTGLLALLFLPKIYA
IYKHNGDPVITSSGIKIENNTRRFIGDEQRDLLCRAEARNRAYKRELVELDHEITRLQRI
LELPLEPYPKMTEELMYLLRETKVDTTPILERKRRTDADRCNSITDADDVAMDFDEEIID
KQKLEKQDSGFHTMSFTKDDAVRTQERSRIRSLIPETDHLDSVVEAASVTRRQSGADGSK
EERTSLLSEDIDSEDVASPEDGVHNDAYAQLQDLSRASPCEAPSRVRILKRELSRIKNEL
RALGEVEMEVSYV
Download sequence
Identical sequences R7V431
jgi|Capca1|204049|fgenesh1_pg.C_scaffold_150000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]