SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|219569|estExt_fgenesh1_pg.C_310036 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|219569|estExt_fgenesh1_pg.C_310036
Domain Number 1 Region: 74-166
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-23
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|219569|estExt_fgenesh1_pg.C_310036
Sequence length 167
Sequence
MEFLLVLLVALAFEGGHADRPTSKNEDMAALLQKIDEIGANVEVIKAAVVSGDDEEEFTG
SPLMIGNAHLGISGNGTRGRLEVFYGEEWGTVCDDDFTDAFAAIICKYLGLPYANAVEIH
NFGGGTGKPIHLDQVDCERAPDARYCKHRGWGVHNCDHSEDLGIECK
Download sequence
Identical sequences R7ULG9
jgi|Capca1|219569|estExt_fgenesh1_pg.C_310036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]