SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|220650|estExt_fgenesh1_pg.C_610012 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|220650|estExt_fgenesh1_pg.C_610012
Domain Number 1 Region: 209-316
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 464-568
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1127-1233
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 323-427
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00043
Further Details:      
 
Domain Number 5 Region: 1405-1513
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00098
Further Details:      
 
Domain Number 6 Region: 789-900
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0022
Further Details:      
 
Domain Number 7 Region: 53-194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000253
Family MAM domain 0.034
Further Details:      
 
Domain Number 8 Region: 427-464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 932-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 10 Region: 638-669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000929
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 11 Region: 1235-1279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|220650|estExt_fgenesh1_pg.C_610012
Domain Number - Region: 756-789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number - Region: 1376-1405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000353
Family LDL receptor-like module 0.0046
Further Details:      
 
Domain Number - Region: 1291-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0017
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number - Region: 983-1010
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00183
Family LDL receptor-like module 0.0043
Further Details:      
 
Domain Number - Region: 673-709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00196
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 1013-1054
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 1098-1128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00798
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|220650|estExt_fgenesh1_pg.C_610012
Sequence length 1556
Sequence
MGVLACSLCFLLLLVPRVAGEVLFEANFDVGGRQDGLSHDEVNSYTRGGSLHYVQWQRQT
GASPTSNTGPDGGQAGSRGYLLFESSYPVSRGDIGRFHVANWQSQYNGQVCISFFYHMHG
STMGNMTMYKQTGSTFTANNQVLWFQRDAHGNQWNAQSVITSLNTATETIGWMAVRGSFY
RSDMGLDTIQISTDVSQCGALPTGGPASDDPTVRLVDGQTSDISTSGRLEILHNGQWGTV
CDDYFGPNSARVFCKMLGFEGTAMFLGNTFGSGSGPIWLDNVQCVGSESTFEECSHLPLG
SHNCGHYEDVSIECFTEAASCDNIEVRLTGGSQDDNSMSGLLEVSYCGRWGTVCDDAFSE
VDARVFCTMLGYTGTARVHDGHGSGQIWLDDVQCSPGMTHISECNHLPWGSHNCGHYEDV
ALQCFDHIVCDASMHRCADGVCVESQRICNGNPDCTDGSDELNCDLEVRLSGGDNGLLQV
RYRGVWGTVCDDFFGYSDALVFCKMLGYKTGAEDHGYHSGGTGQIWLDDLDCTGQESSIS
DCRHIGWGNHNCNHGEDVYLRCTNMNFHYLVSYYAVTMAHNRDQSNNNEIDFHSLKFKQY
IYFGLKIQGLFISATPPVPIPSSDGWCTYRNTPYVLPACQNANRCVRFDQICNGYDDCGD
NTDEQNCACNAQHAWPCADGSGCITAYSGQFCDGTNHCADGSDENHPVCDYYASAPATSY
SSPHWWMPRPQQTATTPYTPPSYTDYSTASPFHSPMYGNCSTGRQVFHIERQGCNGVDDC
TDGTDERNCGDDVQMRLIDGRAEGEGYFQVLRAGVWGFVCDDGINDVTGEALCRMLGYSQ
YSGFTSRYTVNNNQEGPIHLDSLSCSRSTNVFSGCTHDSWGRHDCINYEDVYLFCNSNMP
TTTPYMGTGGTGGTGGTGGVIRPVNGWCRYSETPYLLRACGDNTCVPFEYICDGIVDCND
RRDELNCDQQCLLKMEFPCHRSFGNVTCLRQRFLCDRYADCSNGADENADFCACNAQHAW
PCADGSGCITAYSGQFCDGTNHCADGSDENHPVCDYYASAPAESYSSPHWWVPFPQTQPP
TTTPYPYDNEYHSRHGNCASDGQYFNIQDQGCNGRNDCSDGTDENNCSDDVQMRLVDGEH
QGEGHLQVLRAGVWGTVCDDDFNDNTGEALCRMLGYSQYSGYTSRYNGNNYQMPIHLDSL
SCSRSTNYFSECTHHSWGSHDCNHQEDVYLYCDSRWCSYGRSPYFLQACDNHTTCIPFDN
VCDGNVNCRDGRDEQNCDCVDGADEDSAFCACNVEHGWPCADGDGCITAESGQFCDGRND
CADGSDETHPVCDYYASAPSATFTSPHWWVPWPRTPSRTTPPTTTLGYIPNRSGNCTTGD
QSFHIASQGCNGVADCVDGTDEQNCGDDVQMRLIDGGAEEGVLQVLYAGVWGTVCDDGFS
HLTGKSICRMMGFSSYVGFRSGHFAAGRTSPILLSGLYCPTDNDNFAGCSHYGWGYHNCN
HYEDIYLRCSSTSLPTTRGPETTIPPRTTPPPPPRPTTSKEINGLDLCSEVTYRMT
Download sequence
Identical sequences R7TRX7
jgi|Capca1|220650|estExt_fgenesh1_pg.C_610012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]