SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|221427|estExt_fgenesh1_pg.C_200090 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|221427|estExt_fgenesh1_pg.C_200090
Domain Number 1 Region: 28-132
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00061
Further Details:      
 
Domain Number 2 Region: 137-245
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00084
Further Details:      
 
Domain Number 3 Region: 259-349
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000445
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|221427|estExt_fgenesh1_pg.C_200090
Sequence length 459
Sequence
MALTGVIILCSALLILVCLDHALAIASTSVRLADGPSQYVGRVEIYHSGSYGTVCDDDID
TNMAIMFCNMMGFNGGSVRGNTYGSGTGMIWVDNIYCPTGADDINDCSFTWGSHNCQHSE
DVSVECAPNNPYYPNEINGLRLVDGSGTVLPWGTLDGYLQIQWVEDWGTVCDDSFSYSEA
EFFCRALGFDRGTVGWSSSNSYITGTIWLDDVSCPTDAKSFSQCTHGGWGIHNCAHSEDV
YLSCATDSYGQSYVPEPKALAMVSDGNDIYGPPHILLSGSYGWICDDGNFDDEVAKVICE
KDFGYNDGQKYIYEGSLIPAMGIMTLNQVHCEGGESSLSDCNYNILNLNASSELSYNDCP
AKALIKCTSALLNNATIIIIVVICVIILAAITIVVACSCYHCNKTNKTGPATQPGGASTL
TVTQQTAVRPPMGAYNGQQPMTSPGICFARKCSSSPLLQ
Download sequence
Identical sequences R7UV86
jgi|Capca1|221427|estExt_fgenesh1_pg.C_200090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]