SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|221672|estExt_fgenesh1_pg.C_7710003 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|221672|estExt_fgenesh1_pg.C_7710003
Domain Number - Region: 217-251
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0732
Family Pentapeptide repeats 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|221672|estExt_fgenesh1_pg.C_7710003
Sequence length 1370
Sequence
MENQNCDSAASEGGGPSSHSGSARSTPNHHRQSPCSSSSGPVSRQETPGPMPKYKYSRDD
LVRFRESPHSHKRPDCLASEHDADEGWDPEKWFRSFDANRGDSPLTSAAREKKRQPEIEK
EPFKRKPSADPKGRLKEEEEEGLGIVLSPQRRSFGTGCHVTTPTPSVKEVGARRSGSPND
LEGRDRRGERRIGSGRIMISREREHEIREPRGRFERDIRDRDVRDRDVRDRDLRERDLRD
RDFRDRDFRDRDHEEHRGFHRVIDRFGGRTDRDRDNRDTRRDFGGDRRGFHDNRGGGYRR
PQHEEKEPEWFTSGPSSQNDVIELHGFEGPKQAKEAKDDHKNRTPHKKTQSPKPEDTAPV
REVKPSNVKSVEEAVPNGRPPSPKKEEAPREQNTEPHSENSVNAASDDANFDFTEFLKID
NIPGLALEDPAEAVPEVMPAGSSRFSQWFQAGGAQQQRSRDKSISEEFSYLDELISGSKS
PAAISPTPPSDPKGMPHLFSPITAASGVHTEQQIHMLQLLQKAQQQQQQQQQQQQQQQQQ
QQQQQQPNTNAMEANLRALLMGANNTKIHSAPPPAMPAGGRVMTAADFEASLSQKLTPPP
APLPAELFNQAPMNFDLEQRALGVPQGRPLMSKQHTVHSNAGFSAGVAATPPLKVGSMMT
VWELEAAMKDNQQPKEDTPRAHQTPEQQRIAQQLHQQQAMKCQDPAVAAAGQVGPAGGMT
AFNKLIGMMEASGSLPQTPKMPKRADGRPLSPLSIPNMNKVEQMQQQIPSKDLVQLQKLL
MQKQQQQQQQQQQQQQQLQVKLQAQQKMQEQIMSIMKQQQSLKPPASPFAGSITVSSSPH
CPSPAMPHQASSLLQQPSASPRAPSPIMFGSQPPMHLTAPSPVHPAALSPTQTLSPTSAL
QHPGLPQRVPSPQELIVHTQAIMQNALIKKQLEDQKERYRKRQQETAPLCYRSSPMDPKG
KSPMITSTTSTPTGCSTPGKVAPAFMPTSVIRKMASEKAEEAKKMADGTPQSQKLPPPIL
KIVKTDSMEESPAEVEEHYDSGFQGTPVTSDPSILVSPPSNDPKVEICVSSIEGDGSSVN
MNLQQKLAEELKARVMDAPQLQQQQQLQQQQARRALMGTGGMPHHAPVPSSPSQITSIHP
GRAIVKNSIQPGLMSPPSQADWSASPGGSTQPMMYRTPGNVPVQRPVVQPSPLSPTANAM
FMQRMMQPRGNAPFALPSSLDARLPGPMPPMSALCQIAAMQQQQQHTQTFSSGLTPAQAA
VVAANTRAVPSTVPSSYNPGVLAMGRTVSPLPPQNFGNRPPVRQDLFNGPRSSGIPNNAQ
MAVLMGHQQSGDTNLTKWFGSDMLKQQLPNMPPLPTQGQRVLTVDEIERR
Download sequence
Identical sequences R7TAP6
jgi|Capca1|221672|estExt_fgenesh1_pg.C_7710003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]