SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|222540|estExt_fgenesh1_pg.C_2030011 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|222540|estExt_fgenesh1_pg.C_2030011
Domain Number 1 Region: 957-1069
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-23
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 2 Region: 104-212
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0031
Further Details:      
 
Domain Number 3 Region: 2431-2545
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000962
Family C-type lectin domain 0.0065
Further Details:      
 
Domain Number 4 Region: 1780-1900
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000111
Family Scavenger receptor cysteine-rich (SRCR) domain 0.03
Further Details:      
 
Domain Number 5 Region: 2169-2386
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000198
Family Pectin lyase 0.092
Further Details:      
 
Domain Number 6 Region: 224-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000384
Family Pectate lyase-like 0.056
Further Details:      
 
Domain Number 7 Region: 374-451
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000301
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 8 Region: 470-802
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000942
Family Galacturonase 0.047
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|222540|estExt_fgenesh1_pg.C_2030011
Domain Number - Region: 1328-1374,1411-1644
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000235
Family Pectin lyase 0.074
Further Details:      
 
Domain Number - Region: 900-945,1012-1078,1110-1178
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000372
Family Galacturonase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|222540|estExt_fgenesh1_pg.C_2030011
Sequence length 2836
Sequence
MGHATLGLLLLSAMLARSAVKAVRCEDITEGGWLDEDCIVRSNTLIKKDLFVEKSTKLTV
NPGVELSFVSGVMLAVNGTLKAEGTETSRIKFTKDGDTVPSWPKDIRLVDEWSVAFGRLQ
LLYKGKWRGVCANSVNWTQEAVDVACKQLGFNNGTFSFVSWSRNDTDFMLYHNPACEGSE
TNILDCPNKNNIQIGHKICLQQQTVHLYCEGTPTSNPASDNWWGLEFYNSTYVLESNGNI
WINESASTLVNVDIEYAGMDPTRQPVPAIRASPTPPHLINVTIKNCALDGTNFTDVKAST
IIHNTLVSNNRGHGIVVESHIGRVSITDSLITDNYGNGVKAKFLDGKHAIFDESLTFCRN
PDVGGAERFPILISGIPNDFPTCSKKFETQENNRITLTFLEMDIEPEATATLEVYDYSSQ
PGALLQRIDIMNGTLPTAITSTYHGIYIVFSRTLPKDERCPTLLDCVKFTLLLDSHPSTK
PEFFMNNTEVSNNTQHGVYVENVRGYVMVNASNILSNQYGAGLRVYGGAGDVHVNASHLD
GNLDNGVNITYDGGLRIFNMSSFDYNLGNGINITLNETSVDNKTRYASQQITEVFNSNFT
SNDGFGIRVGNYCRSHEDESMRSSTPDKIVKNKVAVNESVFRDNMLDGVNLESCFRIIPE
ANMTNFTLAYNQFFNNHGHGIRINPLLNAVGRISNNTFMNHSRHALLIDNTDDFLKNREY
SVLPVRYEIEWNSFYLNRGFYVANVRLTQGSTVQWCDFKFNTFTDNVIEGRNPVLNERTH
AYAVVIISSSNVNFSRNHLENPQSKYELATMLLDQSSMLECTRQYWTTTDYDDIIPRIFD
QFNRYNLARIEYHPVLRDGNLNTPAVTHDLTPIEIPFSRGDYLGGRLAVEFTTEGGKTYR
VDRDISIISDGKFIVSPGTKLEFHNALGLYVEGYVKFDGNENEQIEMYLADEETLVNHTS
VRLADGADEFEGRLEVRPEGEDEWGTVCGKGWTIVNSAVVCQMLGMVVHPDDWLVYANVP
APNSVPIWRSSVDCTVLDMNVLDCNADGINDHSCNHTNDVYVKCKPPTWAGIQFAATAAS
SLMKHTSISYAGLMDPAAILFSPAIKIAYNTHTLENLVIENNMADGLEIMKNDVFSNTKL
SHSIVRNNFGNGVASRTSYFEVHFCTLQDNAKSGFEYNPHYTTYEAQQIRFGIHDALVLK
EESMSYRLPDEGRKFVTTEQKFEMEENQIYTLEIFANDRHRVNMDIIDYNPDTHNENVTV
YESRAADITENTISWTLEDDLVDFPITSAEDVLTVRWRVNGMSSGRFAFVVRSKLYSWRW
PFGLIKVTNTTTQGNKNGIITRHYNQPSDEFLDLFFRYRWETINMYGVTFKNNLEEALKV
PSITKYNELYMPTYEELQIPEKLAEIHYELDSNFFLENGGGVVGEHNHVEFSNNVWIWEV
SHNRFERNRDGGFMIELPKVNLMYTELYNHSVDINDTVFEDNDNFAFRIDGFYCNSSIAR
NRWEKNRCKVGCITIAGTEKDFEMTDNQIYENSGKYIMEFNMQSHTPYTRWVDAQMQYND
IKRNRPLDDQQKENTIVSSTPTSYAFGVKGLQNITINRNLFDNYMDYELIGGQDSSSLEN
YLDVTENYWGTIDQVEIREKIFDFDNWNSYAIAEYYPYLLSDDFSGLLSTGGKQNPVFDP
TKPLGGRIEENTELPYRDEPYIVERDLTVMPDVSLLIRPGVELQFYPNIGILVLGSLSAV
GTEDKRIRFNPIAKSDIVTYSRKKRQTDVKELNAAPEGEGMQVRLIGGETDHDGWIEIYN
STERRWAMMCDDSFNDRTAEVACKTMGKEYSNVLVTTHRYYDIYVLGYPKMHEQVIEWFW
RRTFVCDGKESNLEQCRFKQNYHLYRCMEAREYIYVRCGPRNLADNYDYWGNLRFSTPEY
EHGNIVPGFSTLDYVDIYGAGILHEERVSAVQSVYRVPTTTHVSVSHCNWNGYEYIAPRD
EYSVTYNSIENNNGFAIGGLVLNGESRYDVPQSSFVPLITSSVPYNVYGMVRMCSTEKLI
LVQDRLLLYYKYVFDTVDCIKVLRSKEPRKQIALRFLQLHMYNDSFYENSVEMYNGEYFD
PQSLIGKVDANSTLFERSIKYETNEFFDTMGIRITASPAYGDFGFIAEVVTLPLSPGWRP
DLGPGLRQTISHCSISNNEGGAFMFMNAGELNPSVIIEQNRITDNGLGMLNITSPPIMDF
YVQNTRMMTISNNYIAYNYGSVAVNTTCNMLSNALYCNVTNNFIAYNSHGESLHIEGHYY
QGFDIRDNYIAYNKPEHRNVIAMFGVSLNFSTNIIYNNTARCILNASVPEQVSINQRYFQ
NSIYDNWAYAENRSTIFLKSAKFSIRDNYLINRQNRYEIVTFNRTKLPEGTYPQVDAANN
WWGGDVESFVSGRIWERRDDDNLIEVTYSPFYKTNASVLNGKCDPGWRQYDSKCYWYFGG
VVDYAVADKHCRTMQGRLAKARDRDWERAFSDMVIQFQENYDELWYTWVYSDWQKSSWCT
SLRNGRINHINCNEMHPFLCEKDPYPQVTIYWRPIIISLGCTGGMAILICLVCCCGLLKS
HQRKNEKITRRLHMKREIAASKASLFSGSRAGTSAGLLHQDVQQQKRRRPPLTQTGEEPD
FFNLAGVTMEESTDSMDKLKNMDSHRPSTPGSSMDYDSSKMGGSSYFDSDLGPVRQRPQY
PQRVENEITSYNPNRSRSRENIFRNEAYDDDMSVVRGRNKSASTLGYQPQKRYSGGADLG
GAYGGYAESSDGYPESTYAPSTSGYPESTMGYPQASRGYLTSTGGASGYSQPDTDTRPSA
GGYVKPPRPRPKESAM
Download sequence
Identical sequences R7V2A4
jgi|Capca1|222540|estExt_fgenesh1_pg.C_2030011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]