SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|222881|estExt_fgenesh1_pg.C_3340003 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|222881|estExt_fgenesh1_pg.C_3340003
Domain Number 1 Region: 51-127
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000863
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|222881|estExt_fgenesh1_pg.C_3340003
Sequence length 247
Sequence
MMRPSALISFFLYGMVSMQSLQPDTRYMVSLADHDLNGTIGVVWRNSSFTSEFTFICDDG
IFSHAAVDVICQEIGFSGGTGEPAVPGVQVNTLQEVRCTGYEPMLENCTWTLGNSHQCNS
TIAIRCNKQKDASFDWLIGISGAILLLLAWITSHLFFRIKSWKATRTRVHPVESQPSTSQ
GPHISRTSILPLAVLPQMKSQRKKCRYPRMSSDAPPPFNPFVLQNVRYLPPPPNYETLFA
APDIDSD
Download sequence
Identical sequences R7UI66
jgi|Capca1|222881|estExt_fgenesh1_pg.C_3340003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]