SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|222886|estExt_fgenesh1_pg.C_3340010 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|222886|estExt_fgenesh1_pg.C_3340010
Domain Number 1 Region: 32-130
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000105
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|222886|estExt_fgenesh1_pg.C_3340010
Sequence length 245
Sequence
MDTFVFTLFILLYGSSMTCSSHLQLSKASMLYGHQQIKGKISVMWKNESTSTEAIYFCDD
EMFDHNAGNVVCRELEYDEAHLQPSVAGSGSWTIHSVQCDGDEVRLEDCSWTVEAKSQCQ
LNVVLKCYNHPEEIHIWKYVAIPIAFIGAIFIFSRKYRTWHVRRFGQRSNACRPPTANVC
VATVCATANQASRSLRPQASGKNQVDPSALTSTLPPQYSTAVSLDTLPPPPAYDTLYSPQ
DQQMK
Download sequence
Identical sequences R7U9D7
jgi|Capca1|222886|estExt_fgenesh1_pg.C_3340010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]