SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|226306|estExt_fgenesh1_pg.C_3460010 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|226306|estExt_fgenesh1_pg.C_3460010
Domain Number 1 Region: 96-193
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|226306|estExt_fgenesh1_pg.C_3460010
Sequence length 273
Sequence
MRILSVALLFLAFHNIHGQDLGSGNERGDVQDLLAKVESLIERIESHEGLIDEVLDVLDT
VNRNVIEIKTKVEDTEGAEGEEEEEIITDPLKIGNSELRLAGGTSRTGRLEVYHAGEWGT
VCDDDFTDEYAAVICKSLGLPFGNAREIHNYGLGMGKPIHLDQVNCEGAEHARHCTHAGW
GVNNCEHYEDLGIHSHIYEESPDEGLADMNGQAPNEYLIPVDSTPDGQSGKLSSSPVAQQ
REESKDGDAAESRVYVQLHGRRPRENPQFKRQY
Download sequence
Identical sequences R7U8E4
jgi|Capca1|226306|estExt_fgenesh1_pg.C_3460010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]