SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|74318|gw1.8173.3.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|74318|gw1.8173.3.1
Domain Number 1 Region: 165-270
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 275-375
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 3 Region: 52-166
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 4 Region: 2-53
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000575
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0026
Further Details:      
 
Domain Number 5 Region: 376-422
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000105
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|74318|gw1.8173.3.1
Sequence length 422
Sequence
SYQSAHFGEGVGRIWLNDVDCTGDEDSIIQCAHANWGTGSCGHGEDIGVACREDGFLRLV
NGASENEGRIEIFHSNQWGTICSKSFGQEEADVLCRSFGYYYLYVSLNSGSVPYQLLHFG
DGSGPIWLDGVDCTGNENSIEQCTNLVWGTNDCGHDEDAGLLCIEHDTVRLVNGENEREG
RVEIAHAGQWGTICDDHFGKQEADVICKSFGYSDGVVVARFGQGAGPIWLDDVACIGNED
SIAQCPHPAWGTHDCSHREDVGVVCSEYVFTKMLFRLVGGTNEHEGRVEVYHSGEWGTIC
DVGFGEDEADVICRSLGYSDGVSYQSAHFGEGVGRIWLNDVDCTGDEDSIIQCAHANWGT
GSCGHGEDIGVACREYGFLRLVNGASENEGRIEIFHSSQWGTICSKSFGQEEADVLCRSF
GY
Download sequence
Identical sequences R7TFE6
jgi|Capca1|74318|gw1.8173.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]