SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|91530|e_gw1.6474.2.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|91530|e_gw1.6474.2.1
Domain Number - Region: 3-58
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000222
Family Pentapeptide repeats 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|91530|e_gw1.6474.2.1
Sequence length 72
Sequence
NCCRIESACTSGCRRKSTCTSSCRLKSVYTSSFRIKSACMTNCRIKSACMSNCRIKSACT
SSRCRIKWCLYE
Download sequence
Identical sequences R7TH69
jgi|Capca1|90479|e_gw1.778.8.1 jgi|Capca1|91530|e_gw1.6474.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]