SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|112340|e_gw1.33.97.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|112340|e_gw1.33.97.1
Domain Number 1 Region: 178-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.14e-55
Family Voltage-gated potassium channels 0.00066
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily POZ domain 4.93e-32
Family Tetramerization domain of potassium channels 0.00000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|112340|e_gw1.33.97.1
Sequence length 535
Sequence
MASVAAWLPFARAAAIGWVPISKGPMPVPPVDHDRTRTDEKVRINVSGQHFETWSHTLSK
YPDSLLGSNEKEFFFDEESKEYFFDRDPELFRHVLNYYRTGKLHFPKHECITAYDEELAF
YGIMPDIIGDCCYEDYRDRKRENSERLMDDRDSENGDHVVTTTLREKMWRAFENPHTSTA
ALVFYYVTGFFIAISVMANVVETIPCGTLPGTKKNPPCGERYEVIFFCLDTACVMIFTAE
YLLRLFAAPDRCKFTRSVMSIIDVVAILPYYIGLGITDNKDLSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLSMAIIIFATVMFYAEKNVVGTDFTSIPESFWY
TIVTMTTLGYGDMVPHTIIGKVVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRK
AQKKARLARIRMAKNASGNAFISSKRKAEEMLLAREMGIEHEDNNEDVFALQHHHMLMCL
ENATEREFVEMEMQHNGAPSKPSNTPPLTPSPSISSLDQSSCCTRRNQKKYQVRL
Download sequence
Identical sequences R7UIP2
jgi|Capca1|112340|e_gw1.33.97.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]