SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|120045|e_gw1.751.18.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|120045|e_gw1.751.18.1
Domain Number 1 Region: 8-34,74-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-23
Family Voltage-gated potassium channels 0.0048
Further Details:      
 
Domain Number 2 Region: 153-252
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-20
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|120045|e_gw1.751.18.1
Sequence length 376
Sequence
MKKQNVRTLSLIVCTFTYLLVGAAVFDSLESQYETQEKEKLESEEKEFRAKYNITGQDYS
RITLNVLRSVPHKAGIQWKFSGAFYFATTVITTIGYGHSAPKTIGGKMFCMCYALAGIPL
NLVMFQSIGERLNIFVTYLLRNIKKCFKFKDLEVSQTNLIVVCMVMSNIVVAGGAGAFSF
YEEWNYIDSFYYCVITLTTIGFGDYVALQRNGDLQHKPEYVAFSLIFILFGLTVVSAAMN
LLVLRFLTMNTDDERKDELEAATAARTAVRLEGDVITANGSIISGQQEGFTQEYSDLTSV
CSCTCYNLQARGSKHRYSVTRSPGKIAHLLPMHQILNSSNSRNAAVGSETTPNDDMDEDT
NSLLRYQLLRQKRNSI
Download sequence
Identical sequences R7TB53
jgi|Capca1|120045|e_gw1.751.18.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]