SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|136516|e_gw1.693.31.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|136516|e_gw1.693.31.1
Domain Number 1 Region: 379-552
Classification Level Classification E-value
Superfamily SPOC domain-like 1.06e-37
Family SPOC domain 0.00038
Further Details:      
 
Domain Number 2 Region: 114-261
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.62e-29
Family Canonical RBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|136516|e_gw1.693.31.1
Sequence length 554
Sequence
MPVRIETVYNNRPYEGYQNYSNSGSGGGGGGSRDQHGDNYRSSYGESRDRDYQSHGHRGG
GGSGGGGGGGGGGGGAGSVTGSTEERRQNFRDGNGGKFPHHLNHIEPEDDDKATRTLFVG
NLDIEITDADLRGVFERYGTVEDVDIKRPQQGNAYAFIKFYNLDMAHRSKVQMSGEYIGK
FQCKIGYGKPTPSPCLWVGGLGQWLSAEVLEREFDRFGVIHRIEWPHGKSFAYVLYDNID
AATAALKDMRGFPLGGSDHRLRVDFADVSHVTGQIPSELRDQLEKKAASANPIKETDPRN
RTSSRNNDWDDAADKLDNRRRFSDHRPEDDDRSFRSSRRDSDRDPLSSPKRQRLLSPGAR
SPNRNGQESHSSDIENARSVAELSKCLPVVWSGALMLKKSAFITRLHLVTGDVAIVDHLM
RDPTSTEMPVLKIDKRLRLDQAKVDDVRSRLLAAGPTGSSVLLALSGSGAEQVPEGMEQR
PIKNLVTYLKQKEAAGIIALPPNNNRAAHKDSGVLHACPPCVFSTEMLTKYAPKLNLESG
KEDYLVIAVVRGSA
Download sequence
Identical sequences R7TF13
jgi|Capca1|136516|e_gw1.693.31.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]