SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|179392|estExt_Genewise1Plus.C_5230019 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|179392|estExt_Genewise1Plus.C_5230019
Domain Number 1 Region: 261-546
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.44e-79
Family Complement components 0.0000244
Further Details:      
 
Domain Number 2 Region: 629-741
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000000262
Family Alpha-macroglobulin receptor domain 0.0026
Further Details:      
 
Domain Number 3 Region: 92-139
Classification Level Classification E-value
Superfamily E set domains 0.000000133
Family SVA-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|179392|estExt_Genewise1Plus.C_5230019
Sequence length 808
Sequence
MGERGQAGQAGPAGPAGPSGPSSDSGTDEALQTPAVTRNSFPESWIWSEISLGDNGKTTI
EYTVPDTITSWVATAIAMNNEDGLGLSNQATMTTFTPFFVSMNLPYSVIRGEEFSLKCTV
FNYLTTDQEVTVTLPVSPNKAFGTRRSINQVEESYETITRKLKVPANGATNAQFWIVPKK
LGHIGVKVIAQSASAADAVERKLLVEAEGVEQEYTRPIFINLNGETQDLTSTVTITLPEK
ELVPDSTFIEITAIGDVMGASINGLESLIKMPYGCGEQNMLNFAPNIYVLQYLEETNQDN
LAIKTKAKDFMKKGYQRELNYQRDDGSFSAFGNSDDEGSTWLSAFVVRCFNQARSYITID
SDDIDKTISWILEHQYSDGQFQEPGRVIHSDMQGGASKGLPMTAYSALALLENDNEYMDQ
VFNGFELRIVDYLEEKLQDPLVQKDVYTMAILAYTLQLADSPSKNQALTILENLASPEGK
ARPPYHQAGASNIEATAYLLMNYVARSDILKALDVTKWIVAQRNAHGGFSSTQDTVVALQ
ALAGVAALTSGDSNLNMDVSVSVGDSFTHDFDIITSDNSIILQSAEPPTDGGVLTIKATG
QGVAIVQVNVKYNVYSVGSKPDLRLNVVTTNKDDGTVEVQMCNAWTSKKTSGMVVTEMGL
LSGHQAIAPKNLIGQVKNLKRVETTEQKVVLYFDEIAENEEAICFMVASKPVEKIINPQP
VQIYSFPYYFPDKRVVGSYSMPQAMASSMCDECAECCEDGYIAGDPVIRTTGSPAYPPFA
GASGVSSNTITLVITFTIATLLSFLLAM
Download sequence
Identical sequences R7TRC9
jgi|Capca1|179392|estExt_Genewise1Plus.C_5230019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]