SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|183922|estExt_Genewise1Plus.C_5630022 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|183922|estExt_Genewise1Plus.C_5630022
Domain Number 1 Region: 239-284,466-545
Classification Level Classification E-value
Superfamily SET domain 1.44e-22
Family Histone lysine methyltransferases 0.04
Further Details:      
 
Domain Number 2 Region: 63-174,208-239
Classification Level Classification E-value
Superfamily TPR-like 3.21e-17
Family Tetratricopeptide repeat (TPR) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|183922|estExt_Genewise1Plus.C_5630022
Sequence length 666
Sequence
MTSSKITMPEGMENIVHAVKAHCEDDLMDKFIDCPSDEDRVNLIWKQRPFQEILTLEPEY
NAKSSTDASMYRQKGNKYFQKKAYLSAIGEYSKSIINAPSKTTIGSENELPLAFANRSAA
LYHFKKYQLSLVDIEAALEYNYPDDMAYKLYDRQGKCYLQLERPKEALESFKKAEESLGK
AKLEEKYLEIWRKNLKSEMAKTSDMKEKDLSPNDEDPKKIKAPALAHLGNETHPNASRAL
RVGSTPEKGRQILADQDICLGEVLMVDQPITSVLFQDHHASRCYHCFQRCLAPFPCFETS
SVIFCSRECRDKAWNTYQKYEYQYAAVLDANFCGKIGQLALRMLLECNLEGVLEFVRGLD
KTGDVDDMEKVGLDKEGKYCSDYRSLYHMKTHADERKPDDLFELAVMSAFLLKVLDDSGF
LRQENNTYNSARDMKSLGGLLLRNIQLILCNAFPIHQMRRPDNFQEPDPEEIGIGLFPTA
ALLNHSCNPEAIVCYYGNKAVVRAIRDIDKNEEISIAYGVTFYDDEELSRRHQLKETHFF
HCTCKACLEGWPMWLEMDQNQPDWLCEACGSILLSDKIEDNKFAKCKKCSHRQNLEDAIN
KLAVSHDRYSTAMAEAMGGRIENALPELMEHLDLQQRYIDQPWRDFTACQVAIKHCFQIL
GNKREA
Download sequence
Identical sequences R7TVI0
jgi|Capca1|183922|estExt_Genewise1Plus.C_5630022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]