SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|18825|estExt_fgenesh1_pm.C_750001 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|18825|estExt_fgenesh1_pm.C_750001
Domain Number 1 Region: 324-611
Classification Level Classification E-value
Superfamily BEACH domain 2.88e-103
Family BEACH domain 0.0000000463
Further Details:      
 
Domain Number 2 Region: 728-985
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.12e-31
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 231-325
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-25
Family PreBEACH PH-like domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|18825|estExt_fgenesh1_pm.C_750001
Sequence length 994
Sequence
METLLPKLPSTEAPSFFEEFQKYCQQEEWMIFMRRQVIPSSEQYDANIFEKLRVQMTTFM
GECHEAMMIASHLRSRERGESKLKFQEELLDSFHKKTKAEERRYQNVRTQLRQQQKYALR
QWRSRWAFYSGDRGIWFDGSKPNAPFWKLSSLENSHRMRPKLIPNYNYDPHLEASALRDN
IGSENESKDLLSLAFAKEALCRDEDIGDDRLGDEEWNLISAANAQGQEEVKVKLSVDCEL
VTIMDVTRGQLEVTNTHVYFLDCSPQKLEGQDFKWSLSQLREIHFRRYNLRRSALEFFLV
DQSNYFLNFKKQDRNKVYSNILRLRPPNLIYATTRSPTELLKDSDLTRKWLQREISNFEY
LMHLNTIAGRTYNDLSQYPVFPWILSNYDSDTLDLDDVSNYRDLSKPIGTINPKTEAEVR
EKYEHFEDPTGSIPNHAFLDPHGALHNTAYTAAGGKANRQFHSIASTWQSQIENANDVKE
LVPEFFYLPEFLENINDFDLGRLQNGHERVDDVVLPRWAVSSYDFINKHNRALESEYVSA
HLHEWIDLIFGYKQRGPAAAEALNVFYYCTYEGAVDLDSISDPVRRKALEGMINNFGQTP
TQLLKDPHPKRMTFDEAITKAGKSDRPLSVFLFLKELATFFVEGAPKEDPVVFICVPKNQ
VKSFITTVTADSMVVVTQHGVCGIHSWLPYNKSISHFYTFEKDTSMFSRKLQRTLGTLFA
PGVSISPWLFAVTHDAKLVLSGGHWDNSLCVYSVPRSKTIASIVRHNNIITCLALDNCGK
HLITGSRDATCIIWDVMQDKYGISTGISTQPLQVLCGHDAEVTAVAISIELDMAVSGSKD
GTVIIYTVRKGTYMRTLRPPHEKGWRLSVQMLAISEVGHVCVYCQHRSIQNPSQEKLTLH
LYSINGKHMSMESIHVPISHMIISGNHLVFGNKQGVLIIKELFGLRTLSSMPLHVPITCL
AVTNGNSHILLGLRDGNILIIGIKRQPEVKPIMG
Download sequence
Identical sequences R7TB50
jgi|Capca1|18825|estExt_fgenesh1_pm.C_750001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]