SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|195251|fgenesh1_pg.C_scaffold_535000007 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|195251|fgenesh1_pg.C_scaffold_535000007
Domain Number 1 Region: 20-116
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 2 Region: 124-221
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|195251|fgenesh1_pg.C_scaffold_535000007
Sequence length 240
Sequence
KRAESTEITISAESFEIPERPVRLVNGNSENQGRIEMFHSGEWGTVXDDGFGLQAALVVC
RSMGYNHGYHYGDARFGEGSGNIWLDGVDCDGDEDSIEQCDHNEWVHHDCNHSKDADKED
RDTEPVEVRLVDGNDEHEGRVEIFYDGQWGTICDDGFDKKKQLFRAMPHHGGHFGSSRGN
IWLDGVSCSGNEVSIDQCLHGVWGSHDYSHTEDAGVTCSNGDQGSGSGVGGGNAYYDQDS
Download sequence
Identical sequences R7TQA7
jgi|Capca1|195251|fgenesh1_pg.C_scaffold_535000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]