SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|213398|fgenesh1_pg.C_scaffold_235000023 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|213398|fgenesh1_pg.C_scaffold_235000023
Domain Number 1 Region: 607-798
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-72
Family Sec7 domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 67-88,354-469,1080-1402,1589-1628
Classification Level Classification E-value
Superfamily ARM repeat 3.4e-23
Family Plakophilin 1 helical region 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|213398|fgenesh1_pg.C_scaffold_235000023
Sequence length 1714
Sequence
MFLTRALEKILADKDIKKAHHSQLKKACEVALGCAAPQPGNSSSALPLPNANTNLIEADK
YFLPFELACQSKCPRIVNAALDCLQKLIAYGHLIGNVPDSTTPGKRLIDRIVEVICGCFS
NGPQTDEGALLTVVTASTCEIHEGTVLLAVRTCYNIYLASKNIVNQTTAKATLTQMLNVI
FSRMENQAAQEKEREKKLKAENEANARMAESDIESYSEVSEAPQLDAVIPAPENDTESLT
PSQSDEQSDIPSPVNSERMISDTASQDTIEAVTGTGRNCFIFSEYFLLFKDTNPEAVAKA
ILEDVVKHVIDTSNEMQEGIGAFSHILQKDAFLVFRSLCKLSMKPLADGPPDPKSHELRS
KILSLQLLLSILQNAGPVFQTNEMFINAIKQYLCVALSRNGVSAVSQVFELSLAIFLTLL
SGFKQHLKMQIEVFFKEIFLYILETSSSCFEHKWMVIQALTRICADAQCVVDIYVNYDCD
LTLANIFERLVNDLSKIAQGRHAMELAIQGPHLTKRRACASRDWIAWSQSSSAWWSGAKT
SMSIHTLTLTSVCAPSDVIYSISSLLVVYLSFESTTSLSSSTASIPSAAPGSNTVSQQDN
PEQFEVRKQQKELWQNGIEMFNKKPKKGLLYLQEQSLLGTTAEDIADFFHNDDRLDKSMI
GDYMGENEKFTKEVMYAYVDLIDFSGMDFVPGLRRFLSGFRLPGEAQKIDRLMEKFAARY
CECNISNEVFASADAAYVLAYSVIMLTTDLHSSQVRNKMTKEQYIKMNRGINDSKDLPQE
YLSAIYDEIADNEIKMKVVASQGKQGMAARDVTSERHRKTLYNMEMEHMAHTAKALMESV
SHVQSNFTTASHLEHVRPMFKLAWTPFLAAFSVGLQDCDDAEIATNCLDGIRCAIRIACI
FHMELERDAYVQALSRFTLLTATSPITEMKAKNIDTIKTLISVAHTDGNYLGKSWLEILK
CISQLDLWIQTVGTDTDFFSQFIINSIARGGKLDSKTMAHLQESMGETSSQSVVVAVDRI
FTGSVKLDGDAIVEFVRALCAVSIDELASLSHPRMFSLQKIVEISYYNMGRIRLQWSRIW
RWIGDHFNKVGCNPNEDIAFFAVDSLRQLSMKFIEKGEFANFRFQKDFLRPFEHIMKRNR
SPTIRDMVVRCVAQMVNSQAYNIRSGWKNIFSVFHLAASDHDEGIVELAFQTTGKIISSI
FEKHFSAVIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRNCARYVAEKPMVMNVTEEDR
VWVRGWFPVLFELSCIINRCKLDVRTRSLTVLFEIIKTYGGSYLPHWWKDLFRIVFRIFD
NMKLPESQNEKAEWMTTTCNHALYAVVDVFTQYYDVLHPILLDELYSQLKWCVQQDNEQL
ARSGTNCLENLVISCGTKFSPPIWAQTTQCIYGIFENTIPYSLLSWKPDTGEGGSSAPNA
DDQGAKSMTSEGEASRKRLDSDQSSASMDSQKPPARLSAKARASAEQRLFTSLLIKCVVQ
LELIQTIDNIVFYPTTSRKEDQENLAAAQVHNRLDLMHEDQGMYQFLASEQLFQLLDCLM
QSHAFAKSFNANHEQRNILWKAGFKGKAKPNLLKQETQSLACTLRILFRMYSDEKRKDHW
PAVQEKLIRVGGEALAYFLSLQSDNHREAWSNLLLLFLTKILKLPDDRFKAHATEYYPHM
CEIILHDMKPELRAILLKFFKRTGVCFQIIRSDA
Download sequence
Identical sequences R7UPR4
jgi|Capca1|213398|fgenesh1_pg.C_scaffold_235000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]