SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|214520|fgenesh1_pg.C_scaffold_2315000002 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|214520|fgenesh1_pg.C_scaffold_2315000002
Domain Number 1 Region: 108-194
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000287
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 
Domain Number 2 Region: 7-94
Classification Level Classification E-value
Superfamily DEATH domain 0.000000184
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|214520|fgenesh1_pg.C_scaffold_2315000002
Sequence length 202
Sequence
MTILSKPRRELLQKKRVGLVKIISLENGLWDLMESSGLVPKSIRDRFKLNKTPDEQVGEL
LNYIGKRTEEDYVTFGKCLNADNQRHVTEMLGIKQQGNFSMSKMTILSKPRRELLRKKRV
ELVNSIRLENGLWDLMESSGLVLKSIRDRFKLNSTPDEQVGKLLDYLGKRTEEDHVTFGK
CLNADNQWHVTQMLGIKPQEFL
Download sequence
Identical sequences R7UXU7
jgi|Capca1|214520|fgenesh1_pg.C_scaffold_2315000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]