SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|214521|fgenesh1_pg.C_scaffold_2315000003 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|214521|fgenesh1_pg.C_scaffold_2315000003
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000518
Family Caspase recruitment domain, CARD 0.0088
Further Details:      
 
Domain Number 2 Region: 110-187
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000137
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|214521|fgenesh1_pg.C_scaffold_2315000003
Sequence length 195
Sequence
MTILSESHKNLLITRRVELVQSIRLGNGLWDLMVSSGLVSKSLRDRFKKSNTPDEQVGEL
LDYLEMRTEEDYETFGECLDKDNQSHVTKMLGITQQGNFSKSKMTILSKPRRELLQKKRV
GLVKSISLENGLWDLMESSGLVSKSIRDRFKLNSTPDEQVGKLLDYLGKRTEEDYVTFGK
CLNADNQSHEEEKNK
Download sequence
Identical sequences R7UWD0
jgi|Capca1|214521|fgenesh1_pg.C_scaffold_2315000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]