SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|222489|estExt_fgenesh1_pg.C_5010017 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|222489|estExt_fgenesh1_pg.C_5010017
Domain Number 1 Region: 62-135
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000118
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|222489|estExt_fgenesh1_pg.C_5010017
Sequence length 260
Sequence
MGSFVLRVTVFSLLCIGAKSSPTPDAHLELTISSMVYRNRERVGKISAILSNQTTSTGEL
FFCDDEVFNQSAANVICGELKYDSAYIQPSIASNGTGMQTIHSVRCAGDERQLSNCSWQV
GVRSQCRMDIVLKCSMKHSGSNRFQWVYIGIPCIVIAVIASSYRRARLYYMHRGQRGQCR
NNPPPTATNTCPVYTTENQASCTPTPYPQPPQKNPADPTDQPGMLPPTYSQTIAEDTSSL
PPPPAYGALYSAPVAPREVK
Download sequence
Identical sequences R7U0L4
jgi|Capca1|222489|estExt_fgenesh1_pg.C_5010017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]