SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|223766|estExt_fgenesh1_pg.C_4000013 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|223766|estExt_fgenesh1_pg.C_4000013
Domain Number 1 Region: 126-214
Classification Level Classification E-value
Superfamily DEATH domain 1.69e-20
Family Caspase recruitment domain, CARD 0.0072
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-16
Family DEATH domain, DD 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|223766|estExt_fgenesh1_pg.C_4000013
Sequence length 220
Sequence
MDQRLFRITLDKIREDLVEIMDLHSMWSLMRSRRVVDRKKEEQIKLNHTSMQQNELLLDY
LMTRTTEDFDAFCECLRKSNQAHVAEMIRSQPVPTVQPAAQPAAQSAAQPKNRPRSNPSS
DGEWGMKEIHKQVLRKNLIALTKDLNPSVILDELIQGDILTMDDKERLSLVKIRRDQAYE
LISILMRKGPNAFWVFLDSLKQTHSHLYHMLSNSLISEGN
Download sequence
Identical sequences R7U2C2
jgi|Capca1|223766|estExt_fgenesh1_pg.C_4000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]