SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|225161|estExt_fgenesh1_pg.C_8710002 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|225161|estExt_fgenesh1_pg.C_8710002
Domain Number 1 Region: 185-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 244-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000864
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|225161|estExt_fgenesh1_pg.C_8710002
Sequence length 326
Sequence
MEKVAVICLVLLVFQAEAGSLRKDNENLVKSLRNLQHLDQALALAMDQASALAMDQASAL
AMDQASALAMDQASALAMDQASALAMDQVLALAMDQASVQAMDQTSTPAGVQALVLAMDQ
VLALAMDQDQALALAMDQASAPAGVQVLPLGLVLPSVAMMEATVGQDTGSVTAFRTVKMD
LMKLAVSSNAFSCDGGSHVIPSQWECDGVDDCDDGTDEHDDCSSVSSAYSVSGGSSHQWW
SGSSYCCDGGSYCMPAYWECDGIEDCNDGTDEHDDCDVSNFGYSWVKKQAKQDAQHYQKV
QHYSKKAVARRDMAKKKLRHKKMLHN
Download sequence
Identical sequences R7TBF5
jgi|Capca1|225161|estExt_fgenesh1_pg.C_8710002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]