SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|46637|gw1.31.72.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|46637|gw1.31.72.1
Domain Number 1 Region: 24-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 2 Region: 130-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 184-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 77-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Laminin-type module 0.008
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|46637|gw1.31.72.1
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0446
Family Laminin-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|46637|gw1.31.72.1
Sequence length 237
Sequence
RQCETCRPGYFNLLPDNDKGCQECICNITGTVNASTECDAVTGQCPCKTNVGGLRCDACL
PGYYTNNFSSPDGCLFCGCEAAGTIPSQPDCDVETGECACKNNVIGKNCDVCKDMYFNLT
ASNVDGCEDCNCDASGSVNASCNVTNGQCYCKPNVTGRTCDQCSVDYYARDSSEFTEKGC
LEVCDCDPNGVVDGDLDCADYGGQCRCKSNVKGRRCDACAPLFYGLNSTHQDGCLPC
Download sequence
Identical sequences R7UDA1
jgi|Capca1|46637|gw1.31.72.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]