SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000386 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000386
Domain Number 1 Region: 145-207
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 832-888
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 720-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 873-925
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 683-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 339-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000107
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 793-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000904
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000386   Gene: ENSMICG00000000423   Transcript: ENSMICT00000000421
Sequence length 1000
Comment pep:novel scaffold:micMur1:scaffold_6368:37145:50311:1 gene:ENSMICG00000000423 transcript:ENSMICT00000000421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALHTMPDSPTTQLERIEDGSECDADQEEEEEEERGEEEEEEIVVEEEEEVEDVAQVEE
VAEVEVGAEEEEEDDDDVEEVLAEEQSPALGTQEQLSPGGDAKSPVLQEKALQASGLPAT
PGDEDLEEEEEEEEEDDDEDDFLTAGSQGLVTFEDVAVYFSLEEWERLDTDQRGLYQEVM
EENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDDMEDH
EEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGLDPGSLGIL
ADGSEAKPFLPSREPGANLLSAWAFPATVAALAGRPETTCDVCGKVFPHRSRLAKHQRYH
AAVKPFGCDECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIHTGER
PYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCPHCGRSFSQSSALARHQAVHTADRPHCC
PDCGQAFRLRADFQRHRRGGGCVEPSGDGPRRESSEAPATVGPEEAEAEPEGPEAGEVER
EPETEAGGEAREEATAAAEVPTPGSKEEPEQDRRFVELGNGLGEGEGPSSHPLGFHFPVH
PKSWLHPDGFPILGLPDFGERLPGDGRPLPGPMGGPLSLEGAGLACDPFGAGAGGGGGLH
AFPAVGCLLAEPAPAFAAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHRCADCGKS
FVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVCGAGFRRR
AHLTAHGRALVERPNACGEGGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGFGHSSDFKR
HRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRSVLVTHQRT
HTGERPYACANCGRRFSQSSHLLTHMKTHRGTAGAPGQAAAPAPASKVQAPAKGPLDVGA
ITGSGERGSTLLEFAGGTSFSSEHQAAFEGPSGAYEESVL
Download sequence
Identical sequences ENSMICP00000000386 ENSMICP00000000386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]