SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002896 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002896
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-43
Family Pleckstrin-homology domain (PH domain) 0.0000537
Further Details:      
 
Domain Number 2 Region: 267-413
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-33
Family SH2 domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 372-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.83e-26
Family Protein kinases, catalytic subunit 0.0000109
Further Details:      
 
Domain Number 4 Region: 540-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.76e-22
Family Protein kinases, catalytic subunit 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002896   Gene: ENSMICG00000003184   Transcript: ENSMICT00000003191
Sequence length 653
Comment pep:novel genescaffold:micMur1:GeneScaffold_810:279834:320799:1 gene:ENSMICG00000003184 transcript:ENSMICT00000003191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKPILEELLLKRSQQKKKMSPNNYKERLFVLTKANLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYGDLHTAVNEEKHRLPIFPDRVLKIPRAVPIL
RMDAPSSSTTLAQYDNDSKKNYGSQPNINMQYIPREDCPDWWQVRKLKSSEDGACSNQRE
RNVVNHTTSKISWGFPESSSSEEEESLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNS
SQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPELIHYHQHNSAGM
ITRLRHPVSTKANKVPASVSLGSGIWELKREEITLLKELGSGQFGVVQLGKWKGQYDVAV
KMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLSYLRNH
GKGLEPSQLLEMCYDVCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVLDD
QYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVVK
VSQGHRLYRPQLASDTIYQIMYSCWHEASLPEKRPTFQQLLSSIEPLREKDKP
Download sequence
Identical sequences ENSMICP00000002896 ENSMICP00000002896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]