SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003600 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003600
Domain Number 1 Region: 239-561
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-55
Family Diacylglycerol kinase-like 0.011
Further Details:      
 
Domain Number 2 Region: 792-916
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-20
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003600
Domain Number - Region: 111-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0247
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003600   Gene: ENSMICG00000003946   Transcript: ENSMICT00000003951
Sequence length 931
Comment pep:novel genescaffold:micMur1:GeneScaffold_975:184952:469685:-1 gene:ENSMICG00000003946 transcript:ENSMICT00000003951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINFRCKPTFREGGSRSPRENFVRHHWV
HRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXNSLKASNRKKKRTSFKRKASKRGTEQENKGRPFVIKPISSPLM
KPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGG
DGTVGWILSILDELQLNPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTI
VQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKF
NSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYC
AGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKS
IPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSVPDRLRIRVNKISLQ
DYEGFHYDKEKLREAXXXXXXXXXXXXXXXXXXXIPLGILVVRGDCDLETCRMYIDRLQE
DLQSVSSGSQRVHYQDRETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILD
PDMVVSQAAGTPPGMPDLVVEQASGVSDWWNPALRKRMLSDSGLGVITPYYEDSDMKDLS
HSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYAAKTGNGEI
VKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQDR
AQQAGDPDLAAYLESRQNYKILGHEDLETAV
Download sequence
Identical sequences ENSMICP00000003600 ENSMICP00000003600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]