SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004243 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004243
Domain Number 1 Region: 283-344
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.00056
Further Details:      
 
Domain Number 2 Region: 106-159
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000004243
Domain Number - Region: 346-400
Classification Level Classification E-value
Superfamily SH3-domain 0.00263
Family SH3-domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004243   Gene: ENSMICG00000004655   Transcript: ENSMICT00000004656
Sequence length 402
Comment pep:novel scaffold:micMur1:scaffold_347:183027:324719:1 gene:ENSMICG00000004655 transcript:ENSMICT00000004656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPSNGAREDGVDGLPKEAASPEQPPSPASPSSQESKLQRLKRSLSFKTKSLRSKSADNF
FQRANSDDVKLQADMLAEVSPSSSPLPVPGSLTSTPARAGLHPGGKAHAFQEHIFKKPTF
CDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPXXXXXX
XXXXXXXXXXXCGNKVDPVYETLRFGTSLAQRTKKSSSGSGSDSPHRTSTSDLVEVPEEA
DGPGGEYDLRKRSNSVFTYPENGTDDFRDQAKNINHQGPLSKDPLQMNTYVALYKFVPQE
NEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRVQQNEKIFRCVRTFIGCKE
QGQITLKENQICVSSEEEQDGFIRVLSGKKRGLIPLDVLENI
Download sequence
Identical sequences ENSMICP00000004243 ENSMICP00000004243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]