SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004732 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000004732
Domain Number - Region: 196-272
Classification Level Classification E-value
Superfamily DEATH domain 0.0314
Family Caspase recruitment domain, CARD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004732   Gene: ENSMICG00000005188   Transcript: ENSMICT00000005188
Sequence length 887
Comment pep:novel genescaffold:micMur1:GeneScaffold_1544:96720:123498:-1 gene:ENSMICG00000005188 transcript:ENSMICT00000005188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKDDPPQLVTPASVKAIISRIETAQLTRAQEDISTQLSDILGNVNCVINRFQEEVGYDL
KEKAKSHQTEKKGKKRFILLEKIASFSKDAKIKEKHLYEILHWLGDWGDSLTYEIRNSRS
EEEEEALDEWIEGIEKVLPLSLLATKEGIKSLISLCSTLLEEQKKRAQMPKCTFWQEWQE
KNPQKTTPYPQPPSPEQMLQDNYTTCMKVFEVKSMLQELLDSNMFDEGEVRAIMYMSTTV
ENLNRALILQHKENRNLETKYKQLKTQKTKDLSSQRLYFQKSIQVLESKRDALLKRVEIL
GGKYHDLLLTKYSLEFQLKKAQTDRCQAEDLAKVLVDSPGPPEKDTFPKKETVLEETQQE
PKKEEQLFSPLPPRPLAMAWDSGATPSAHQLFSTLTTHSKIVDVFSSKGTESLEPLLLSS
EDHKFPKKYERLVTESSDHKDKDQEDYFQEKERLQINSHFRKQLSLENFRKMPSQSQAEH
WEEELSWEKRRQQWLEEEEMWLQRQKKWALLEEEHQEKLRQWEMEDAARQQQHRFDQPEK
EQESPRKELEQPKEDMERMIFTRTNRWRDLEKAEPLLVFPRTRAQSAHQVRRPPLPRSPN
TQQSALGNRRPMSSMGFTHKQQAHCVPTKPKKSASFPIAGSSIRGVTKPSLQISPATVKE
KVYHIDMEAQRKNLQLLSEESELGLPQYLRSKALDLTTTSMELNTFRLQYLCHKYILYRC
FQSLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLQQEWNIHLNIPVVTSPKPRKCKSPPAVSQRIRPFPSKHWESAPLQMACQQ
GKQMEAVWKTDVASSSHPVEKKTPASLPRDQLGGHPDIPQPLVLDVH
Download sequence
Identical sequences ENSMICP00000004732 ENSMICP00000004732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]