SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007029 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007029
Domain Number 1 Region: 280-439
Classification Level Classification E-value
Superfamily Caspase-like 1.83e-18
Family Caspase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily DEATH domain 8.95e-17
Family DEATH domain, DD 0.011
Further Details:      
 
Domain Number 3 Region: 171-254
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000352
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 69-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000142
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007029   Gene: ENSMICG00000007719   Transcript: ENSMICT00000007726
Sequence length 771
Comment pep:novel genescaffold:micMur1:GeneScaffold_216:461412:533367:1 gene:ENSMICG00000007719 transcript:ENSMICT00000007726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRRLAELAGRRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAM
EHTEVLQLLSPPGIKIVVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEXXXXXXX
XXXXXXVHVDAGFVCRNNNTFEFSKWSQLDVCDVTDVTESFQGSLDGISESKLQICVEPR
SQKLMPGSTLVLQCVAIGSPIPHYQWFKNESPLTHETKKLYMVPYVDLEHQGTYWCHVYN
DRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYW
EHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYXXXXXXX
XXXXXXXXXXXXXXDAPNPYRFENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTI
PILDALKVTANIVFGYATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLDIDPKDANKGTPEET
GSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTIEEKQEVNVGKPLIAK
LDIHRGLGRKTCFQTCLMSNGPYQSSVSTPGGAGHYHSSQDSFHGVYHSHMGNSNNVMPS
DSCHCSRTPDAFISSYRAHHYSCQFGRSNVPVETTDEIPFSFSDRLRISEK
Download sequence
Identical sequences ENSMICP00000007029 ENSMICP00000007029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]