SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008282 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008282
Domain Number 1 Region: 665-909
Classification Level Classification E-value
Superfamily RNI-like 1.28e-59
Family 28-residue LRR 0.013
Further Details:      
 
Domain Number 2 Region: 869-1095
Classification Level Classification E-value
Superfamily RNI-like 8.5e-57
Family 28-residue LRR 0.0038
Further Details:      
 
Domain Number 3 Region: 181-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000037
Family G proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008282   Gene: ENSMICG00000009086   Transcript: ENSMICT00000009094
Sequence length 1102
Comment pep:novel genescaffold:micMur1:GeneScaffold_862:43160:78484:-1 gene:ENSMICG00000009086 transcript:ENSMICT00000009094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEMAIPGAAARTRRPLSVGGRQQSRALSSQLLAAIPDSMRKQEVRTGGEAGQGHGTGSPA
EQVKALVDLLAGKGGQGSQALQAPDRTPDFPLGPHHNDLRIQRHREALLSRAGGGREPSA
SPRLPTLLLVEGLTDLQLREHDFTQVEATRGRWRPARAIALDRLFLPLSRVSIPPRVSVT
IGVAGMGKTTLVRHFVRLWARGQVGKDFSLVLPLTFRDLNTHEKLCADRLIRSAFPHVGE
PSLVLAAPARVLLILDGLDECKTPLDFSNTVACTDPRREIQVDHLITNIIRGNLFPEVSI
WITSRPSAAGQIPGGLVDRMTEIRGFNEDEISLCLEQMFPEDQTLSGWVLSQVRADRALY
LMCTVPAFCRLAGSVLGYLCRNRPGAQDAELWPPRTLCELYSWYLRMAFSREGQEKGKAS
PRIEQVAHGCRKMVGTLGRLAFHGLVKKKYVFYEQDMKALGVDLALLQGAPCSCFLQREE
TLASSAAYCFTHLSLQEFVAAVYYYGASKKAIFDLFTESGVSWPRLGFLTHFRSAAQRAM
HAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAPGEHQGYRAQAAELLQGCLRPDAVVCAR
AVNVLHCLHELRHTELACSMEEAMERGALARLTGPLHRATVAYLLQVSDACAQEANLSLC
LSQGVLQSLLPQLLYCQSLRLDANQFQDPVMDLLGSVLSGKDCRIQKISLAENQISNKGA
KALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQSNTIRDDGARSMA
EALASNRALSVLHLQKNTIGPVGAQRMADALKQNKNLKELMLSSNSIGDGGTKALAEALK
VNQGLESLDLQSNSISDSGVAALTGALCTNRTLLSLNLRENSISPEGAQALAHALCTNST
LENLDLTANLLHDQGAQAIAVAVGKNRALTSLHLQWNFIQAGAAKALGQALQLNGSLTSL
DLQENAIGDEGASAVASALKANTALTALYLQVASIGIPGAQALGEALAVNRTLEILDLRG
NAIGMAGAKALASALKVNSSLRRLNLQENSLGMDGAICIATALSGNHQLQHINLQGNHIG
ESGARMISEAIKTNAPTCTVEM
Download sequence
Identical sequences ENSMICP00000008282 ENSMICP00000008282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]