SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009140 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009140
Domain Number 1 Region: 811-1059
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-84
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 641-726
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-28
Family Eukaryotic proteases 0.0072
Further Details:      
 
Domain Number 3 Region: 492-549
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.03e-17
Family Eukaryotic proteases 0.0068
Further Details:      
 
Domain Number 4 Region: 151-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009140   Gene: ENSMICG00000010010   Transcript: ENSMICT00000010032
Sequence length 1060
Comment pep:novel genescaffold:micMur1:GeneScaffold_1737:46216:81429:1 gene:ENSMICG00000010010 transcript:ENSMICT00000010032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTAAGLQLVPRATKEVPSPDAACCRVAVTGLVATVVVVLTLGVLLAFLSTQGVHVDHT
AELRGVPWADSLRQEGSNYRRALTPPREALLHFLLRALQPLSLALVEELLQQGIRARLRE
HDITLAAYGTIASVELLXXXXXXXXXXXXXXXHCPGSAFSCRNSQCVTKVNPECDDRVDC
SDESDEAHCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXCGARPAMEKPTRIVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPELLQKASVGILDQKACSV
LYNFSLTDRMLCAGFLEGKVDSCQGDSGGPLACEETPGMFYLAGIVSWGIGCAQAKKPGV
YASITRLKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGLAPAAAMTRIVGGSAAGLGEWP
WQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGSEGHVERVE
RIYKHPFYNLYTLDYDVALLELAGPVRHSRLVRPICLPEPAPRAPDGARCVITGWGSVRE
GGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPS
GRWVLTGVTSWGYGCGRPHFPGVYTRVSAVRGWIGQNIQE
Download sequence
Identical sequences ENSMICP00000009140 ENSMICP00000009140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]